Atlas Antibodies Anti-MYPN Antibody

상품 한눈에 보기

휴먼 MYPN 단백질을 타깃으로 하는 폴리클로날 항체로, IHC Orthogonal 검증 완료. Rabbit 유래 IgG 항체이며, Affinity purification 방식으로 정제됨. RNA-seq 데이터 기반 단백질 발현 비교 검증 지원. Human 시료에 적합.

카탈로그번호: HPA061494-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061494-100 Anti-MYPN Antibody, myopalladin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061494-25 Anti-MYPN Antibody, myopalladin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MYPN Antibody

Anti-MYPN Antibody

Target: myopalladin
Type: Polyclonal Antibody against Human MYPN

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody targeting Human MYPN (myopalladin)
Validated for orthogonal IHC applications
Produced in Rabbit, purified by affinity using PrEST antigen

Alternative Gene Names

MYOP

Open Datasheet (PDF)

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EDLSNNGSLHSANSTTNLAAIEPQPSPPHSEPPSVEQPPKPKLEGVLVNHNEPRSSSRIGLRVHFNLPEDDKGSEASSE

Species Reactivity

Species	Reactivity	Gene ID / Ortholog	Sequence Identity
Human	Verified	MYPN	100%
Rat	Predicted	ENSRNOG00000000383	80%
Mouse	Predicted	ENSMUSG00000020067	80%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage / Handling	Gently mix before use. Determine optimal concentrations and conditions for each application.