CacheBy
Atlas Antibodies Anti-MYOT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MYOT Antibody

상품 한눈에 보기

인간 MYOT 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC와 RNA-seq 데이터 비교를 통한 정교한 Orthogonal Validation 제공. 토끼 유래 IgG 항체로 PrEST 항원 기반 친화 정제. 근육 관련 질환 연구에 적합.

카탈로그번호
HPA037734-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037734-100 Anti-MYOT Antibody, myotilin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037734-25 Anti-MYOT Antibody, myotilin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MYOT Antibody

Anti-MYOT Antibody

Target: myotilin
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human MYOT


Alternative Gene Names

LGMD1, LGMD1A, TTID

Open Datasheet


Antigen Information

  • Target Protein: myotilin
  • Target Gene: MYOT
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQG

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Rat ENSRNOG00000047186 79%
Mouse ENSMUSG00000024471 78%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.