
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MYOC Antibody
상품 한눈에 보기
Human MYOC 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간 시료에 검증됨. GLC1A/JOAG1/TIGR 유전자 타겟.
- 카탈로그번호
- HPA027364-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027364-100 Anti-MYOC Antibody, myocilin, trabecular meshwork inducible glucocorticoid response 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027364-25 Anti-MYOC Antibody, myocilin, trabecular meshwork inducible glucocorticoid response 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MYOC Antibody
Anti-MYOC Antibody
Target: myocilin, trabecular meshwork inducible glucocorticoid response
Type: Polyclonal Antibody against Human MYOC
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human MYOC (myocilin, trabecular meshwork inducible glucocorticoid response).
Alternative Gene Names
GLC1A, JOAG1, TIGR
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | myocilin, trabecular meshwork inducible glucocorticoid response |
| Target Gene | MYOC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000003221 (79%), Mouse ENSMUSG00000026697 (79%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



