Atlas Antibodies Anti-MYO1F Antibody

상품 한눈에 보기

Human MYO1F 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 기반 정합 검증에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인체 시료 연구용으로 권장.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055242-100 Anti-MYO1F Antibody, myosin IF 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055242-25 Anti-MYO1F Antibody, myosin IF 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: myosin IF
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human MYO1F.

항목	내용
Target Protein	myosin IF
Target Gene	MYO1F
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000024300 (73%), Rat ENSRNOG00000008409 (72%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.