Atlas Antibodies Anti-MYO1A Antibody

상품 한눈에 보기

Human MYO1A 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증 완료. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. RNA-seq 데이터 기반 Orthogonal Validation으로 높은 신뢰성 제공. Human 반응성 확인.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADBIX 2026 전시회10/28~30 코엑스 · 사전등록 안내자세히보기

Atlas Antibodies HPA053490-100 Anti-MYO1A Antibody, myosin IA 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053490-25 Anti-MYO1A Antibody, myosin IA 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MYO1A Antibody

Anti-MYO1A Antibody

Target Protein: myosin IA
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human MYO1A

Alternative Gene Names

DFNA48, MYHL

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

FSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRY

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000025401	82%
Rat	ENSRNOG00000004177	78%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand