Atlas Antibodies Anti-MYH11 Antibody

상품 한눈에 보기

Human MYH11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol 버퍼에 보존되어 안정적입니다.

카탈로그번호: HPA015310-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA015310-100 Anti-MYH11 Antibody, myosin, heavy chain 11, smooth muscle 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA015310-25 Anti-MYH11 Antibody, myosin, heavy chain 11, smooth muscle 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MYH11 Antibody

Anti-MYH11 Antibody

Target: myosin, heavy chain 11, smooth muscle
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human MYH11

Alternative Gene Names

SMHC, SMMHC

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	myosin, heavy chain 11, smooth muscle
Target Gene	MYH11
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (90%), Rat (89%)

Antigen Sequence:
LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand