CacheBy
Atlas Antibodies Anti-MYH14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MYH14 Antibody

상품 한눈에 보기

사람 MYH14 단백질을 인식하는 폴리클로날 항체로, 비근육성 미오신 중쇄 14 연구에 적합합니다. 토끼에서 생산된 IgG 형태이며, 높은 종 간 반응성을 보입니다. PrEST 항원을 이용해 친화 정제되었으며, 다양한 응용에 사용할 수 있습니다.

카탈로그번호
HPA067889-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067889-100 Anti-MYH14 Antibody, myosin, heavy chain 14, non-muscle 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067889-25 Anti-MYH14 Antibody, myosin, heavy chain 14, non-muscle 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MYH14 Antibody

Anti-MYH14 Antibody

Target Information

  • Target Protein: Myosin, heavy chain 14, non-muscle
  • Target Gene: MYH14
  • Alternative Gene Names: DFNA4, FLJ13881, KIAA2034, MHC16, MYH17

Product Description

Polyclonal antibody against human MYH14.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000030739): 94%
  • Rat (ENSRNOG00000020014): 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Recommended Applications ICC (Immunocytochemistry)

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.