Atlas Antibodies Anti-MYH10 Antibody

상품 한눈에 보기

인간 MYH10 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human 반응성 확인, 연구용 비임상 시약.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047541-100 Anti-MYH10 Antibody, myosin, heavy chain 10, non-muscle 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047541-25 Anti-MYH10 Antibody, myosin, heavy chain 10, non-muscle 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: myosin, heavy chain 10, non-muscle
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal Antibody against Human MYH10

항목	내용
Target Protein	myosin, heavy chain 10, non-muscle
Target Gene	MYH10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000002886 (97%), Mouse ENSMUSG00000020900 (96%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.