CacheBy
Atlas Antibodies Anti-MYBPC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MYBPC2 Antibody

상품 한눈에 보기

Human MYBPC2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Orthogonal validation으로 RNA-seq 데이터와 일치하는 신뢰성 검증 완료.

카탈로그번호
HPA042991-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042991-100 Anti-MYBPC2 Antibody, myosin binding protein C, fast type 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042991-25 Anti-MYBPC2 Antibody, myosin binding protein C, fast type 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MYBPC2 Antibody

Anti-MYBPC2 Antibody

Target: myosin binding protein C, fast type
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human MYBPC2.


Alternative Gene Names

MGC163408, MYBPC, MYBPCF

Open Datasheet


Target Information

항목 내용
Target Protein myosin binding protein C, fast type
Target Gene MYBPC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTA
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000038670 (82%), Rat ENSRNOG00000019627 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.