
원본
Atlas Antibodies Anti-MX1 Antibody
상품 한눈에 보기
Human MX1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. IHC 및 WB 실험에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation을 거쳤습니다. 고순도 Affinity Purified 제품으로 안정적이며 재현성 높은 결과를 제공합니다.
- 카탈로그번호
- HPA049724-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049724-100 Anti-MX1 Antibody, MX dynamin-like GTPase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049724-25 Anti-MX1 Antibody, MX dynamin-like GTPase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MX1 Antibody
Anti-MX1 Antibody
MX dynamin-like GTPase 1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal Validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human MX1
Alternative Gene Names
IFI-78K, MxA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | MX dynamin-like GTPase 1 |
| Target Gene | MX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000001959 (60%), Mouse ENSMUSG00000000386 (56%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



