
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MVK Antibody
상품 한눈에 보기
인간 MVK(mevalonate kinase)에 특이적인 폴리클로날 항체로, IHC 및 Western blot에 적합. 재조합 단백질 발현 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.
- 카탈로그번호
- HPA044110-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044110-100 Anti-MVK Antibody, mevalonate kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044110-25 Anti-MVK Antibody, mevalonate kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MVK Antibody
Anti-MVK Antibody
Target: Mevalonate kinase (MVK)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human mevalonate kinase (MVK).
Alternative Gene Names
LRBP, MK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mevalonate kinase |
| Target Gene | MVK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLEELIDMNQHHLNALGVGHASLDQLC |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (74%) |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



