CacheBy
Atlas Antibodies Anti-MVB12B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MVB12B Antibody

상품 한눈에 보기

Human MVB12B 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종간 보존성을 보임. 40% glycerol 기반 버퍼에 보존되어 안정적임.

카탈로그번호
HPA049383-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049383-100 Anti-MVB12B Antibody, multivesicular body subunit 12B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049383-25 Anti-MVB12B Antibody, multivesicular body subunit 12B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MVB12B Antibody

Anti-MVB12B Antibody

Target: multivesicular body subunit 12B (MVB12B)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MVB12B protein.


Alternative Gene Names

C9orf28, FAM125B, FLJ00001

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein multivesicular body subunit 12B
Target Gene MVB12B
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVL

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 동일도
Rat ENSRNOG00000017172 96%
Mouse ENSMUSG00000038740 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.