CacheBy
Atlas Antibodies Anti-MUT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MUT Antibody

상품 한눈에 보기

Human MUT 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat에 반응하며, PrEST 항원을 사용했습니다.

카탈로그번호
HPA035972-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035972-100 Anti-MUT Antibody, methylmalonyl CoA mutase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035972-25 Anti-MUT Antibody, methylmalonyl CoA mutase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MUT Antibody

Anti-MUT Antibody

Target Protein: methylmalonyl CoA mutase
Product Type: Polyclonal Antibody against Human MUT


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal antibody raised in rabbit against Human methylmalonyl CoA mutase (MUT).
Validated for use in IHC and WB applications.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein methylmalonyl CoA mutase
Target Gene MUT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALK

Species Reactivity

  • Verified: Human, Mouse, Rat
  • Sequence Identity:
    • Rat ENSRNOG00000050843 (94%)
    • Mouse ENSMUSG00000023921 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.