Atlas Antibodies Anti-MURC Antibody

상품 한눈에 보기

휴먼 MURC 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Orthogonal 및 Recombinant Expression 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 정제된 고품질 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021021-100 Anti-MURC Antibody, muscle-related coiled-coil protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021021-25 Anti-MURC Antibody, muscle-related coiled-coil protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: muscle-related coiled-coil protein (MURC)
Type: Polyclonal Antibody against Human MURC

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
WB (Recombinant Expression validation): Validation using target protein overexpression.
ICC: Immunocytochemistry applications supported.

Polyclonal antibody targeting the human muscle-related coiled-coil protein (MURC).

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:

KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000028348	64%
Rat	ENSRNOG00000008027	59%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions experimentally.