CacheBy
Atlas Antibodies Anti-MTX2 Antibody
원본

Atlas Antibodies Anti-MTX2 Antibody

상품 한눈에 보기

Human MTX2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보임. 40% glycerol/PBS 완충액에 보존제로 sodium azide 포함.

카탈로그번호
HPA031552-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031552-100 Anti-MTX2 Antibody, metaxin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031552-25 Anti-MTX2 Antibody, metaxin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTX2 Antibody

Anti-MTX2 Antibody

Target Information

  • Target Protein: metaxin 2
  • Target Gene: MTX2
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MTX2.
Validated for use in multiple applications.
Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000027099 98%
Rat ENSRNOG00000001559 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.