CacheBy
Atlas Antibodies Anti-MTMR9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTMR9 Antibody

상품 한눈에 보기

Human MTMR9 단백질을 타깃하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. WB 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되었고, glycerol/PBS 버퍼로 안정화되어 있습니다.

카탈로그번호
HPA070944-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070944-100 Anti-MTMR9 Antibody, myotubularin related protein 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070944-25 Anti-MTMR9 Antibody, myotubularin related protein 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTMR9 Antibody

Anti-MTMR9 Antibody

Target Information

  • Target Protein: Myotubularin related protein 9
  • Target Gene: MTMR9
  • Alternative Gene Names: C8orf9, DKFZp434K171, LIP-STYX, MTMR8
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MTMR9.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    LSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity (%)
Rat ENSRNOG00000011560 91%
Mouse ENSMUSG00000035078 88%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.