
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTFR1L Antibody
상품 한눈에 보기
Human MTFR1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 사용 가능. 재조합 단백질 발현을 통한 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, 인간 시료에 반응.
- 카탈로그번호
- HPA027124-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027124-100 Anti-MTFR1L Antibody, mitochondrial fission regulator 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027124-25 Anti-MTFR1L Antibody, mitochondrial fission regulator 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTFR1L Antibody
Anti-MTFR1L Antibody
Target: mitochondrial fission regulator 1-like (MTFR1L)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- Recombinant expression validation in WB using target protein overexpression
Product Description
Polyclonal antibody against human MTFR1L.
Alternative Gene Names
- FAM54B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial fission regulator 1-like |
| Target Gene | MTFR1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEED |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046671 | 94% |
| Rat | ENSRNOG00000016937 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



