
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTFP1 Antibody
상품 한눈에 보기
인간 MTFP1 단백질을 인식하는 토끼 폴리클로날 항체로, 미토콘드리아 분열 과정 연구에 적합. HSPC242, MTP18 유전자 대체명. PrEST 항원을 이용한 친화정제 방식으로 제조. Human에 대해 검증된 반응성을 가짐.
- 카탈로그번호
- HPA077396-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA077396-100 Anti-MTFP1 Antibody, mitochondrial fission process 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077396-25 Anti-MTFP1 Antibody, mitochondrial fission process 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTFP1 Antibody
Anti-MTFP1 Antibody
Target: mitochondrial fission process 1 (MTFP1)
Alternative Gene Names: HSPC242, MTP18
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MTFP1, designed for research use in mitochondrial fission process studies.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial fission process 1 |
| Target Gene | MTFP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000001870 (35%), Rat ENSRNOG00000054624 (35%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



