Atlas Antibodies Anti-MTERF4 Antibody

상품 한눈에 보기

인간 MTERF4 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됩니다. 미토콘드리아 전사 종료 인자 연구에 유용합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027097-100 Anti-MTERF4 Antibody, mitochondrial transcription termination factor 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027097-25 Anti-MTERF4 Antibody, mitochondrial transcription termination factor 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Mitochondrial transcription termination factor 4
Type: Polyclonal antibody against human MTERF4

IHC (Immunohistochemistry)
WB (Western Blot, recombinant expression validation using target protein overexpression)
ICC (Immunocytochemistry)

Polyclonal antibody against human MTERF4, validated for multiple applications.

MGC61716, MTERFD2

항목	내용
Target Protein	Mitochondrial transcription termination factor 4
Target Gene	MTERF4
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000037376 (55%), Mouse ENSMUSG00000026273 (54%)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ARQTPHLGEQRRTTASLLRKLTTASNGGVIEELSCVRSNNYVQEPECRRNLVQCLLEKQGTPVVQGSLELERVMSSLLDMGFSNAHINELLSVRRGASLQQLLDIISEFILLGLNPEPVCVVLKKSPQLL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet