CacheBy
Atlas Antibodies Anti-MTBP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTBP Antibody

상품 한눈에 보기

인간 MTBP(MDM2 binding protein)을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 Affinity purification 방식으로 정제되었습니다. IHC 및 WB 실험에 적합합니다. 높은 종간 반응성(마우스 93%, 랫 91%)을 보입니다.

카탈로그번호
HPA025694-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025694-100 Anti-MTBP Antibody, MDM2 binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025694-25 Anti-MTBP Antibody, MDM2 binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTBP Antibody

Anti-MTBP Antibody

Target Information

  • Target Protein: MDM2 binding protein
  • Target Gene: MTBP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIEYCLDDRKALERDGGFSELQSRLIRYETQTTCTR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000022369 (93%)
  • Rat ENSRNOG00000004412 (91%)

Product Description

Polyclonal Antibody against Human MTBP
Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.