
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRRF Antibody
상품 한눈에 보기
인간 MRRF 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증된 연구용 시약입니다.
- 카탈로그번호
- HPA049987-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049987-100 Anti-MRRF Antibody, mitochondrial ribosome recycling factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049987-25 Anti-MRRF Antibody, mitochondrial ribosome recycling factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRRF Antibody
Anti-MRRF Antibody
Target: mitochondrial ribosome recycling factor
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MRRF
Alternative Gene Names
RRF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosome recycling factor |
| Target Gene | MRRF |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKAKAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSV |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000026887 | 74% |
| Rat | ENSRNOG00000025997 | 71% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



