
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPL48 Antibody
상품 한눈에 보기
인간 MRPL48 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적 PBS/glycerol 버퍼에 보존됩니다.
- 카탈로그번호
- HPA040864-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040864-100 Anti-MRPL48 Antibody, mitochondrial ribosomal protein L48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040864-25 Anti-MRPL48 Antibody, mitochondrial ribosomal protein L48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPL48 Antibody
Anti-MRPL48 Antibody
Target Information
- Target Protein: Mitochondrial ribosomal protein L48
- Target Gene: MRPL48
- Alternative Gene Name: CGI-118
Product Description
Polyclonal antibody against human MRPL48.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:KPIYSVGGILLSISRPYKTKPTHGIGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000018042 (79%)
- Mouse ENSMUSG00000030706 (78%)
Recommended Applications
면역조직화학(IHC) 등 다양한 응용에 적합합니다.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Verified Species Reactivity | Human |
| Alternative Gene Name | CGI-118 |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
Open Datasheet (PDF)
Material Safety Data Sheet (Sodium Azide)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



