CacheBy
Atlas Antibodies Anti-MRPL48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL48 Antibody

상품 한눈에 보기

인간 MRPL48 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적 PBS/glycerol 버퍼에 보존됩니다.

카탈로그번호
HPA040864-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040864-100 Anti-MRPL48 Antibody, mitochondrial ribosomal protein L48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040864-25 Anti-MRPL48 Antibody, mitochondrial ribosomal protein L48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL48 Antibody

Anti-MRPL48 Antibody

Target Information

  • Target Protein: Mitochondrial ribosomal protein L48
  • Target Gene: MRPL48
  • Alternative Gene Name: CGI-118

Product Description

Polyclonal antibody against human MRPL48.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KPIYSVGGILLSISRPYKTKPTHGIGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000018042 (79%)
  • Mouse ENSMUSG00000030706 (78%)

면역조직화학(IHC) 등 다양한 응용에 적합합니다.

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Verified Species Reactivity Human
Alternative Gene Name CGI-118

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)
Material Safety Data Sheet (Sodium Azide)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.