
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ASAP3 Antibody
상품 한눈에 보기
Human ASAP3 단백질을 인식하는 토끼 폴리클로날 항체로, ArfGAP with SH3 domain, ankyrin repeat 및 PH domain 3을 타깃으로 함. IHC 등 다양한 응용에 적합하며, 친화 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020537-100 Anti-ASAP3 Antibody, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020537-25 Anti-ASAP3 Antibody, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ASAP3 Antibody
Anti-ASAP3 Antibody
Target Information
- Target Protein: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
- Target Gene: ASAP3
- Alternative Gene Names: CENTB6, DDEFL1, FLJ20199, UPLC1
Product Description
Polyclonal antibody against human ASAP3.
Recommended Applications
- Immunohistochemistry (IHC)
- Other applications to be optimized by the user
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000049714 (82%)
- Mouse ENSMUSG00000036995 (79%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



