CacheBy
Atlas Antibodies Anti-ARVCF Antibody
원본

Atlas Antibodies Anti-ARVCF Antibody

상품 한눈에 보기

Human ARVCF 단백질에 특이적인 Rabbit Polyclonal 항체로, ICC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 96% 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055264-100 Anti-ARVCF Antibody, armadillo repeat gene deleted in velocardiofacial syndrome 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055264-25 Anti-ARVCF Antibody, armadillo repeat gene deleted in velocardiofacial syndrome 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARVCF Antibody

Anti-ARVCF Antibody

Target: armadillo repeat gene deleted in velocardiofacial syndrome (ARVCF)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ARVCF.

Open Datasheet


Target Information

  • Target Protein: armadillo repeat gene deleted in velocardiofacial syndrome
  • Target Gene: ARVCF
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    HVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDPGTPTSHVSIV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000001888 96%
Mouse ENSMUSG00000098615 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.