
원본
Atlas Antibodies Anti-ARVCF Antibody
상품 한눈에 보기
Human ARVCF 단백질에 특이적인 Rabbit Polyclonal 항체로, ICC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 96% 서열 동일성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055264-100 Anti-ARVCF Antibody, armadillo repeat gene deleted in velocardiofacial syndrome 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055264-25 Anti-ARVCF Antibody, armadillo repeat gene deleted in velocardiofacial syndrome 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARVCF Antibody
Anti-ARVCF Antibody
Target: armadillo repeat gene deleted in velocardiofacial syndrome (ARVCF)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ARVCF.
Target Information
- Target Protein: armadillo repeat gene deleted in velocardiofacial syndrome
- Target Gene: ARVCF
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDPGTPTSHVSIV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001888 | 96% |
| Mouse | ENSMUSG00000098615 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



