CacheBy
Atlas Antibodies Anti-ARSJ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARSJ Antibody

상품 한눈에 보기

Human ARSJ 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. 40% glycerol 기반 buffer로 장기 보관이 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036481-100 Anti-ARSJ Antibody, arylsulfatase family, member J 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036481-25 Anti-ARSJ Antibody, arylsulfatase family, member J 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARSJ Antibody

Anti-ARSJ Antibody

Target: arylsulfatase family, member J (ARSJ)
Product Type: Polyclonal Antibody against Human ARSJ


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is produced in rabbit and targets the human ARSJ protein, a member of the arylsulfatase family. It is affinity purified using the PrEST antigen as the affinity ligand to ensure high specificity.


Alternative Gene Names

  • FLJ23548

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein arylsulfatase family, member J
Target Gene ARSJ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK

Species Reactivity

반응성 항원 서열 유사도
Human Verified -
Mouse Predicted 97%
Rat Predicted 52%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.