Atlas Antibodies Anti-ARSB Antibody

상품 한눈에 보기

Human ARSB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Affinity purification 방식으로 정제되었으며, 40% glycerol 기반 PBS buffer에 보존됩니다.

카탈로그번호: HPA037771-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037771-100 Anti-ARSB Antibody, arylsulfatase B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037771-25 Anti-ARSB Antibody, arylsulfatase B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ARSB Antibody

Anti-ARSB Antibody

Target: arylsulfatase B

Recommended Applications

Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ARSB.

Open Datasheet

Target Information

항목	내용
Target Protein	arylsulfatase B
Target Gene	ARSB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	YPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYF
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000011150 (82%), Mouse ENSMUSG00000042082 (80%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet