
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ARRB2 Antibody
상품 한눈에 보기
Human ARRB2 단백질을 인식하는 Rabbit Polyclonal 항체로, arrestin beta 2 단백질 검출에 적합합니다. Recombinant PrEST 항원을 이용해 정제되었으며, 인체 반응성이 검증되었습니다. ICC 등 다양한 응용에 사용할 수 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075177-100 Anti-ARRB2 Antibody, arrestin beta 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075177-25 Anti-ARRB2 Antibody, arrestin beta 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARRB2 Antibody
Anti-ARRB2 Antibody
Target: arrestin, beta 2
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ARRB2 (arrestin, beta 2).
Alternative Gene Names
ARR2, BARR2, DKFZp686L0365
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | arrestin, beta 2 |
| Target Gene | ARRB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DLFIATYQAFPPVPNPPRPPTRLQDRLLRKL |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000019308 | 94% |
| Mouse | ENSMUSG00000060216 | 94% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



