Atlas Antibodies Anti-ARPC1B Antibody

상품 한눈에 보기

인간 ARPC1B 단백질에 대한 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간, 생쥐, 랫드 반응성이 검증되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증이 완료되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004832-100 Anti-ARPC1B Antibody, actin related protein 2/3 complex, subunit 1B, 41kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004832-25 Anti-ARPC1B Antibody, actin related protein 2/3 complex, subunit 1B, 41kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ARPC1B Antibody

Anti-ARPC1B Antibody

Actin related protein 2/3 complex, subunit 1B, 41kDa

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human ARPC1B

Alternative Gene Names

ARC41, p40-ARC, p41-ARC

Open Datasheet

Target Information

항목	내용
Target Protein	Actin related protein 2/3 complex, subunit 1B, 41kDa
Target Gene	ARPC1B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000000991 (94%), Mouse ENSMUSG00000029622 (94%)

Antigen Sequence:

TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand