Atlas Antibodies Anti-ARMC6 Antibody

상품 한눈에 보기

Human ARMC6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041420-100 Anti-ARMC6 Antibody, armadillo repeat containing 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041420-25 Anti-ARMC6 Antibody, armadillo repeat containing 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ARMC6 Antibody

Anti-ARMC6 Antibody

Target Protein: armadillo repeat containing 6
Target Gene: ARMC6
Product Type: Polyclonal Antibody against Human ARMC6

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit and targets the human ARMC6 protein. It is affinity purified using the PrEST antigen as the affinity ligand, ensuring high specificity and purity.

Alternative Gene Names

MGC19595

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LSNIVKTAPKVSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVL

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000002343	73%
Rat	ENSRNOG00000020280	72%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Store as recommended by manufacturer.
Safety	Contains sodium azide (Material Safety Data Sheet)