CacheBy
Atlas Antibodies Anti-ARMC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARMC3 Antibody

상품 한눈에 보기

인체 ARMC3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인할 수 있습니다. PrEST 항원으로 친화 정제되었으며, 인간에 대해 검증된 반응성을 갖습니다.

카탈로그번호
HPA037824-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037824-100 Anti-ARMC3 Antibody, armadillo repeat containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037824-25 Anti-ARMC3 Antibody, armadillo repeat containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARMC3 Antibody

Anti-ARMC3 Antibody

Target: armadillo repeat containing 3 (ARMC3)
Type: Polyclonal Antibody against Human ARMC3
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody designed to detect human ARMC3 protein.

Alternative Gene Names: CT81, FLJ32827
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein armadillo repeat containing 3
Target Gene ARMC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000016716 89%
Mouse ENSMUSG00000037683 88%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.