원본

Atlas Antibodies Anti-ARMC2 Antibody

상품 한눈에 보기

Human ARMC2 단백질을 인식하는 고품질 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 신뢰성 높은 단백질 발현 분석에 적합함. Rabbit 유래 IgG, PrEST 항원으로 정제되어 다양한 연구 응용에 사용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053696-100 Anti-ARMC2 Antibody, armadillo repeat containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053696-25 Anti-ARMC2 Antibody, armadillo repeat containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: armadillo repeat containing 2 (ARMC2)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human ARMC2

bA787I22.1, DKFZp434P0714

항목	내용
Target Protein	armadillo repeat containing 2
Target Gene	ARMC2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000026217 (70%) Mouse ENSMUSG00000071324 (65%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.