
Atlas Antibodies Anti-ARL1 Antibody
상품 한눈에 보기
인간 ARL1 단백질을 인식하는 폴리클로날 항체로 웨스턴 블롯(WB)과 면역세포화학(ICC)에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인체, 마우스, 랫트에서 100% 교차 반응성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARL1 Antibody
Target Information
- Protein: ADP-ribosylation factor-like 1
- Gene: ARL1
- Alternative Gene Name: ARFL1
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ARL1.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
ALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000060904 | 100% |
| Rat | ENSRNOG00000005763 | 100% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




