CacheBy
Atlas Antibodies Anti-ARHGDIA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARHGDIA Antibody

상품 한눈에 보기

Human ARHGDIA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. GDIA1/RHOGDI로도 알려진 Rho GDP dissociation inhibitor alpha를 표적합니다. 고순도 Affinity 정제 방식으로 제조되었으며, PBS/glycerol buffer에 보존됩니다.

카탈로그번호
HPA021407-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021407-100 Anti-ARHGDIA Antibody, Rho GDP dissociation inhibitor (GDI) alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021407-25 Anti-ARHGDIA Antibody, Rho GDP dissociation inhibitor (GDI) alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARHGDIA Antibody

Anti-ARHGDIA Antibody

Rho GDP dissociation inhibitor (GDI) alpha

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ARHGDIA.

Alternative Gene Names

  • GDIA1
  • RHOGDI

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Rho GDP dissociation inhibitor (GDI) alpha
Target Gene ARHGDIA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000036688 (100%)
Mouse ENSMUSG00000025132 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.