
1 / 2
Atlas Antibodies Anti-ARHGAP44 Antibody
상품 한눈에 보기
인간 ARHGAP44 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 높은 종간 서열 유사성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARHGAP44 Antibody
Rho GTPase activating protein 44
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human ARHGAP44
Alternative Gene Names
KIAA0672, RICH-2, RICH2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rho GTPase activating protein 44 |
| Target Gene | ARHGAP44 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000003603 (93%), Mouse ENSMUSG00000033389 (92%) |
Antigen Sequence:
STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP40 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP45 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP42 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.