
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ARHGAP27 Antibody
상품 한눈에 보기
인간 ARHGAP27 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 토끼 유래 IgG 항체이며, 프레스티지 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 40% 글리세롤 PBS 완충액에 보존되어 있습니다.
- 카탈로그번호
- HPA053053-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053053-100 Anti-ARHGAP27 Antibody, Rho GTPase activating protein 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053053-25 Anti-ARHGAP27 Antibody, Rho GTPase activating protein 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARHGAP27 Antibody
Anti-ARHGAP27 Antibody
Target Information
- Target Protein: Rho GTPase activating protein 27
- Target Gene: ARHGAP27
- Alternative Gene Names: CAMGAP1, FLJ43547, SH3D20, SH3P20
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ARHGAP27.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000034255 | 93% |
| Rat | ENSRNOG00000028569 | 93% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Base Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



