
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ARFGAP1 Antibody
상품 한눈에 보기
인간 ARFGAP1 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가지며 안정적인 PBS-글리세롤 버퍼에 보존됩니다.
- 카탈로그번호
- HPA051019-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051019-100 Anti-ARFGAP1 Antibody, ADP-ribosylation factor GTPase activating protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051019-25 Anti-ARFGAP1 Antibody, ADP-ribosylation factor GTPase activating protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARFGAP1 Antibody
Anti-ARFGAP1 Antibody
ADP-ribosylation factor GTPase activating protein 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Immunocytochemistry (ICC)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ARFGAP1
Alternative Gene Names
- ARF1GAP
- bA261N11.3
- FLJ10767
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADP-ribosylation factor GTPase activating protein 1 |
| Target Gene | ARFGAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000027575 (69%), Rat ENSRNOG00000043150 (67%) |
Antigen Sequence:
DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



