원본

Atlas Antibodies Anti-APOLD1 Antibody

상품 한눈에 보기

인간 APOLD1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며, 글리세롤 및 PBS 버퍼에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058882-100 Anti-APOLD1 Antibody, apolipoprotein L domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058882-25 Anti-APOLD1 Antibody, apolipoprotein L domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: apolipoprotein L domain containing 1 (APOLD1)
Type: Polyclonal Antibody against Human APOLD1

Polyclonal antibody targeting human APOLD1, suitable for research applications in protein localization and expression studies.

항목	내용
Target Protein	apolipoprotein L domain containing 1
Target Gene	APOLD1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASI
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000007830 (87%), Mouse ENSMUSG00000090698 (85%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Information	Material Safety Data Sheet
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.