CacheBy
Atlas Antibodies Anti-APOC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-APOC4 Antibody

상품 한눈에 보기

인간 APOC4 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 연구용 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

카탈로그번호
HPA062671-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062671-100 Anti-APOC4 Antibody, apolipoprotein C-IV 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062671-25 Anti-APOC4 Antibody, apolipoprotein C-IV 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-APOC4 Antibody

Anti-APOC4 Antibody

Target Information

  • Target Protein: apolipoprotein C-IV
  • Target Gene: APOC4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000018405 (69%)
  • Mouse ENSMUSG00000074336 (69%)

Product Description

Polyclonal Antibody against Human APOC4

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications Immunohistochemistry (IHC)
Verified Reactivity Human

Usage Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험에 맞게 결정해야 합니다.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.