CacheBy
Atlas Antibodies Anti-APOB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-APOB Antibody

상품 한눈에 보기

Human APOB 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형식으로 IHC, ICC 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대한 반응성 검증 완료.

카탈로그번호
HPA049793-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049793-100 Anti-APOB Antibody, apolipoprotein B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049793-25 Anti-APOB Antibody, apolipoprotein B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-APOB Antibody

Anti-APOB Antibody

Target Information

  • Target Protein: apolipoprotein B
  • Target Gene: APOB
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000005542 78%
Mouse ENSMUSG00000020609 76%

Product Description

Polyclonal antibody against human apolipoprotein B (APOB).

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.