CacheBy
Atlas Antibodies Anti-APC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-APC Antibody

상품 한눈에 보기

Human APC 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013362-100 Anti-APC Antibody, APC, WNT signaling pathway regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013362-25 Anti-APC Antibody, APC, WNT signaling pathway regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-APC Antibody

Anti-APC Antibody

Target Protein: adenomatous polyposis coli (APC)

IHC (Immunohistochemistry) 등 다양한 면역 분석에 사용 가능

Product Description

Polyclonal antibody against human APC protein.

Alternative Gene Names

DP2, DP2.5, DP3, PPP1R46

Open Datasheet (PDF)

Target Information

  • Target Protein: adenomatous polyposis coli
  • Target Gene: APC

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000005871 89%
Rat ENSRNOG00000020423 87%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 희석 배수 및 조건은 사용 목적에 따라 사용자가 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.