
원본
Atlas Antibodies Anti-AP4M1 Antibody
상품 한눈에 보기
인간 AP4M1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합. 높은 종간 반응성(마우스 97%, 랫 96%) 확인. PrEST 항원으로 친화 정제된 고품질 항체.
- 카탈로그번호
- HPA066774-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066774-100 Anti-AP4M1 Antibody, adaptor-related protein complex 4, mu 1 subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066774-25 Anti-AP4M1 Antibody, adaptor-related protein complex 4, mu 1 subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AP4M1 Antibody
Anti-AP4M1 Antibody
Target: adaptor-related protein complex 4, mu 1 subunit
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal Antibody against Human AP4M1
Alternative Gene Names
MU-4, MU-ARP2, SPG50
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adaptor-related protein complex 4, mu 1 subunit |
| Target Gene | AP4M1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000019518 (97%), Rat ENSRNOG00000001353 (96%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



