CacheBy
Atlas Antibodies Anti-AP3D1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AP3D1 Antibody

상품 한눈에 보기

Human AP3D1 단백질을 인식하는 토끼 폴리클로날 항체로, adaptor-related protein complex 3의 delta 1 서브유닛을 타깃으로 함. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human 반응성 검증 완료.

카탈로그번호
HPA074408-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074408-100 Anti-AP3D1 Antibody, adaptor-related protein complex 3, delta 1 subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074408-25 Anti-AP3D1 Antibody, adaptor-related protein complex 3, delta 1 subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AP3D1 Antibody

Anti-AP3D1 Antibody

Target: adaptor-related protein complex 3, delta 1 subunit
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human AP3D1.


Alternative Gene Names

  • ADTD

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adaptor-related protein complex 3, delta 1 subunit
Target Gene AP3D1
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020198 (93%), Rat ENSRNOG00000018977 (93%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
IRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAG


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.