Atlas Antibodies Anti-AP1AR Antibody

상품 한눈에 보기

Human AP1AR 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. 재조합 발현 검증 완료. 고순도 친화정제 제품으로 안정적인 신호 검출과 높은 특이성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035863-100 Anti-AP1AR Antibody, adaptor-related protein complex 1 associated regulatory protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035863-25 Anti-AP1AR Antibody, adaptor-related protein complex 1 associated regulatory protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: adaptor-related protein complex 1 associated regulatory protein
Supplier: Atlas Antibodies

Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against Human AP1AR.

2C18, C4orf16, gamma-BAR, PRO0971

항목	내용
Target Protein	adaptor-related protein complex 1 associated regulatory protein
Target Gene	AP1AR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000024492 (94%), Mouse ENSMUSG00000074238 (90%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand