CacheBy
Atlas Antibodies Anti-ANXA8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANXA8 Antibody

상품 한눈에 보기

Human ANXA8 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성 제공. ICC 등 다양한 응용에 적합. Human, Mouse, Rat에 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047451-100 Anti-ANXA8 Antibody, annexin A8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047451-25 Anti-ANXA8 Antibody, annexin A8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANXA8 Antibody

Anti-ANXA8 Antibody

Target Information

  • Target Protein: annexin A8
  • Target Gene: ANXA8
  • Alternative Gene Names: ANX8

Product Description

Polyclonal antibody against Human ANXA8.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LGTKEGVIIEILASRTKNQLREIMKAYEEDYG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000021950 (100%)
  • Rat: ENSRNOG00000060949 (100%)

Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.