CacheBy
Atlas Antibodies Anti-ANXA2R Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANXA2R Antibody

상품 한눈에 보기

Human ANXA2R를 인식하는 Rabbit Polyclonal Antibody로 IHC 및 ICC에 적합. PrEST 항원을 이용한 친화 정제 방식. Human 반응성 검증 완료. 안정적인 PBS/glycerol buffer에 보존.

카탈로그번호
HPA051482-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051482-100 Anti-ANXA2R Antibody, annexin A2 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051482-25 Anti-ANXA2R Antibody, annexin A2 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANXA2R Antibody

Anti-ANXA2R Antibody

Target Information

  • Target Protein: annexin A2 receptor
  • Target Gene: ANXA2R
  • Alternative Gene Names: AXIIR, C5orf39

Product Description

Polyclonal antibody against Human ANXA2R.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    EYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDR

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000036057 33%
Rat ENSRNOG00000020862 30%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.