CacheBy
Atlas Antibodies Anti-ANKS6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANKS6 Antibody

상품 한눈에 보기

Human ANKS6 단백질을 인식하는 폴리클로날 항체로, WB와 ICC에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가집니다.

카탈로그번호
HPA008355-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008355-100 Anti-ANKS6 Antibody, ankyrin repeat and sterile alpha motif domain containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008355-25 Anti-ANKS6 Antibody, ankyrin repeat and sterile alpha motif domain containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANKS6 Antibody

Anti-ANKS6 Antibody

Target: ankyrin repeat and sterile alpha motif domain containing 6 (ANKS6)

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ANKS6.

Alternative Gene Names

ANKRD14, FLJ36928, NPHP16, SAMD6

Open Datasheet (PDF)

Target Information

  • Target Protein: ankyrin repeat and sterile alpha motif domain containing 6
  • Target Gene: ANKS6
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000023309 98%
Mouse ENSMUSG00000066191 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.