Atlas Antibodies Anti-ANKS1A Antibody

상품 한눈에 보기

Human ANKS1A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응하며, 안정적인 PBS/glycerol buffer에 보존됩니다.

카탈로그번호: HPA036768-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036768-100 Anti-ANKS1A Antibody, ankyrin repeat and sterile alpha motif domain containing 1A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036768-25 Anti-ANKS1A Antibody, ankyrin repeat and sterile alpha motif domain containing 1A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ANKS1A Antibody

Anti-ANKS1A Antibody

Target: ankyrin repeat and sterile alpha motif domain containing 1A
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ANKS1A.

Alternative Gene Names

ANKS1
KIAA0229

Open Datasheet

Target Information

Target Protein: ankyrin repeat and sterile alpha motif domain containing 1A
Target Gene: ANKS1A
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
VVQILLAAGTDVNIKDNHGLTALDTVRELPSQKSQQIAALIEDHMTGKRSTKEVDKTPPPQPPLISSMDSISQKSQGDVEKAVTELIIDFDANAEEEGP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat ENSRNOG00000000498 (76%)
Mouse ENSMUSG00000024219 (76%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen as affinity ligand