Atlas Antibodies Anti-ANKS3 Antibody

상품 한눈에 보기

Human ANKS3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 보존용액은 PBS와 글리세롤 기반입니다.

카탈로그번호: HPA041409-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041409-100 Anti-ANKS3 Antibody, ankyrin repeat and sterile alpha motif domain containing 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041409-25 Anti-ANKS3 Antibody, ankyrin repeat and sterile alpha motif domain containing 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ANKS3 Antibody

Anti-ANKS3 Antibody

Target: ankyrin repeat and sterile alpha motif domain containing 3 (ANKS3)
Type: Polyclonal Antibody against Human ANKS3

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody produced in rabbit, targeting the human ANKS3 protein. Affinity purified using the PrEST antigen as affinity ligand, ensuring high specificity and reproducibility.

Alternative Gene Names

FLJ32345, FLJ32767, KIAA1977

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	ankyrin repeat and sterile alpha motif domain containing 3
Target Gene	ANKS3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD

Species Reactivity

종	반응성
Human	Verified
Mouse	63% sequence identity (ENSMUSG00000022515)
Rat	63% sequence identity (ENSRNOG00000003186)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide (Material Safety Data Sheet)