CacheBy
Atlas Antibodies Anti-MRPL33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL33 Antibody

상품 한눈에 보기

인체 MRPL33 단백질을 인식하는 토끼 폴리클로날 항체입니다. 미토콘드리아 리보솜 단백질 L33 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol 완충액에 보존되어 안정적입니다.

카탈로그번호
HPA066872-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066872-100 Anti-MRPL33 Antibody, mitochondrial ribosomal protein L33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066872-25 Anti-MRPL33 Antibody, mitochondrial ribosomal protein L33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL33 Antibody

Anti-MRPL33 Antibody

Target Information

  • Target Protein: Mitochondrial ribosomal protein L33
  • Target Gene: MRPL33
  • Alternative Gene Names: C2orf1, RPL33L

Product Description

Polyclonal antibody against human MRPL33.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MFLSAVFFAKSKSKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000025388 78%
Mouse ENSMUSG00000106918 76%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.