Atlas Antibodies Anti-MRPL28 Antibody

상품 한눈에 보기

Human MRPL28 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었고 Rat, Mouse와 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030594-100 Anti-MRPL28 Antibody, mitochondrial ribosomal protein L28 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030594-25 Anti-MRPL28 Antibody, mitochondrial ribosomal protein L28 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial ribosomal protein L28
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human MRPL28

MAAT1, p15

항목	내용
Target Protein	mitochondrial ribosomal protein L28
Target Gene	MRPL28
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000042720 (81%), Mouse ENSMUSG00000024181 (80%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.